IL22 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6216P
Article Name: IL22 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6216P
Supplier Catalog Number: CNA6216P
Alternative Catalog Number: MBL-CNA6216P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 20kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200