Placental alkaline phosphatase (PLAP) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6353S
Article Name: Placental alkaline phosphatase (PLAP) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6353S
Supplier Catalog Number: CNA6353S
Alternative Catalog Number: MBL-CNA6353S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human Placental alkaline phosphatase (PLAP) (NP_001623.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 58kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human Placental alkaline phosphatase (PLAP) (NP_001623.3).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:50 - 1:100