FIBP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6436S
Article Name: FIBP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6436S
Supplier Catalog Number: CNA6436S
Alternative Catalog Number: MBL-CNA6436S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human FIBP (NP_004205.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLV
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human FIBP (NP_004205.2).
Application Dilute: WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000