RAMP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6447S
Article Name: RAMP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6447S
Supplier Catalog Number: CNA6447S
Alternative Catalog Number: MBL-CNA6447S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-148 of human RAMP1 (NP_005846.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 17kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: AVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Target: A synthetic peptide corresponding to a sequence within amino acids 50-148 of human RAMP1 (NP_005846.1).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200