[KO Validated] CIRBP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6559S
Article Name: [KO Validated] CIRBP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6559S
Supplier Catalog Number: CNA6559S
Alternative Catalog Number: MBL-CNA6559S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (NP_001271.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 19kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (NP_001271.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:10 - 1:100