CPSF3L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6566S
Article Name: CPSF3L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6566S
Supplier Catalog Number: CNA6566S
Alternative Catalog Number: MBL-CNA6566S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 331-600 of human CPSF3L (NP_060341.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 68kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 331-600 of human CPSF3L (NP_060341.2).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100|IP,1:100 - 1:500