HOXB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6619S
Article Name: HOXB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6619S
Supplier Catalog Number: CNA6619S
Alternative Catalog Number: MBL-CNA6619S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human HOXB1 (NP_002135.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 32kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human HOXB1 (NP_002135.2).
Application Dilute: WB: WB,1:2000 - 1:4000|IF/ICC,1:50 - 1:200