HSPA2 Rabbit mAb, Clone: [ARC1415], Unconjugated, Monoclonal

Catalog Number: MBL-CNA6652S
Article Name: HSPA2 Rabbit mAb, Clone: [ARC1415], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA6652S
Supplier Catalog Number: CNA6652S
Alternative Catalog Number: MBL-CNA6652S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1415]
Molecular Weight: 70kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200