OSMR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6681P
Article Name: OSMR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6681P
Supplier Catalog Number: CNA6681P
Alternative Catalog Number: MBL-CNA6681P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of human OSMR (NP_003990.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 111kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of human OSMR (NP_003990.1).
Application Dilute: WB: WB,1:500 - 1:1000