P2RX4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6682S
Article Name: P2RX4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6682S
Supplier Catalog Number: CNA6682S
Alternative Catalog Number: MBL-CNA6682S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 55-338 of human P2RX4 (NP_002551.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 43kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: QETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 55-338 of human P2RX4 (NP_002551.2).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100