TOM20 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6774P
Article Name: TOM20 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6774P
Supplier Catalog Number: CNA6774P
Alternative Catalog Number: MBL-CNA6774P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200