Thioredoxin 2 (Trx2/TXN2) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Thioredoxin 2 (Trx2/TXN2) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA6782S
• Supplier Catalog Number: CNA6782S
• Alternative Catalog Number: MBL-CNA6782S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 18kDa
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
• Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2).

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200