WRN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6855S
Article Name: WRN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6855S
Supplier Catalog Number: CNA6855S
Alternative Catalog Number: MBL-CNA6855S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1223-1432 of human WRN (NP_000544.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 162kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: CQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1223-1432 of human WRN (NP_000544.2).
Application Dilute: WB: WB,1:200 - 1:1000