ALPPL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6866S
Article Name: ALPPL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6866S
Supplier Catalog Number: CNA6866S
Alternative Catalog Number: MBL-CNA6866S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-280 of human ALPPL2 (NP_112603.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 57kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 20-280 of human ALPPL2 (NP_112603.2).
Application Dilute: WB: WB,1:500 - 1:2000