GALNT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6910S
Article Name: GALNT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6910S
Supplier Catalog Number: CNA6910S
Alternative Catalog Number: MBL-CNA6910S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 442-571 of human GALNT2 (NP_004472.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 65kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: HQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 442-571 of human GALNT2 (NP_004472.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|IHC-P,1:100 - 1:500