PMS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6947T
Article Name: PMS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6947T
Supplier Catalog Number: CNA6947T
Alternative Catalog Number: MBL-CNA6947T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (NP_000526.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 96kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQ
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (NP_000526.2).
Application Dilute: WB: WB,1:1000 - 1:5000