PRKAB2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6952P
Article Name: PRKAB2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6952P
Supplier Catalog Number: CNA6952P
Alternative Catalog Number: MBL-CNA6952P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PRKAB2 (NP_005390.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PRKAB2 (NP_005390.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200