NCOR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7046S
Article Name: NCOR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7046S
Supplier Catalog Number: CNA7046S
Alternative Catalog Number: MBL-CNA7046S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NCOR1 (NP_006302.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 270kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQIL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NCOR1 (NP_006302.2).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100