RRAS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7076S
Article Name: RRAS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7076S
Supplier Catalog Number: CNA7076S
Alternative Catalog Number: MBL-CNA7076S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-204A of human RRAS2 (NP_036382.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 23kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-204A of human RRAS2 (NP_036382.2).
Application Dilute: WB: WB,1:500 - 1:2000