REST/NRSF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7161T
Article Name: REST/NRSF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7161T
Supplier Catalog Number: CNA7161T
Alternative Catalog Number: MBL-CNA7161T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human REST/NRSF (NP_005603.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 122kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEERQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human REST/NRSF (NP_005603.3).
Application Dilute: WB: WB,1:100 - 1:500