HDAC5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7189S
Article Name: HDAC5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7189S
Supplier Catalog Number: CNA7189S
Alternative Catalog Number: MBL-CNA7189S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC5 (NP_005465.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 122kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: RALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLL
Target: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC5 (NP_005465.2).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50