[KO Validated] LC3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7198S1
Article Name: [KO Validated] LC3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7198S1
Supplier Catalog Number: CNA7198S1
Alternative Catalog Number: MBL-CNA7198S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human LC3B (NP_073729.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 15kDa
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKT
Target: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human LC3B (NP_073729.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200