Kallistatin (SERPINA4) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7320S
Article Name: Kallistatin (SERPINA4) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7320S
Supplier Catalog Number: CNA7320S
Alternative Catalog Number: MBL-CNA7320S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 178-427 of human Kallistatin (SERPINA4) (NP_006206.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 178-427 of human Kallistatin (SERPINA4) (NP_006206.2).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:100