PEX3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7352S
Article Name: PEX3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7352S
Supplier Catalog Number: CNA7352S
Alternative Catalog Number: MBL-CNA7352S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 144-373 of human PEX3 (NP_003621.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 144-373 of human PEX3 (NP_003621.1).
Application Dilute: WB: WB,1:500 - 1:2000