PRDM5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7361S
Article Name: PRDM5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7361S
Supplier Catalog Number: CNA7361S
Alternative Catalog Number: MBL-CNA7361S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 73kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200