WISP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7456S1
Article Name: WISP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7456S1
Supplier Catalog Number: CNA7456S1
Alternative Catalog Number: MBL-CNA7456S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 164-250 of human WISP2 (NP_003872.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 27kDa
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: GQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 164-250 of human WISP2 (NP_003872.1).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200