EIF4G1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7552S
Article Name: EIF4G1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7552S
Supplier Catalog Number: CNA7552S
Alternative Catalog Number: MBL-CNA7552S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 175kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PEELLNGAPSPPAVDLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTPIPANLSQNLE
Target: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IP,1:100 - 1:500