GLUT4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7637S1
Article Name: GLUT4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7637S1
Supplier Catalog Number: CNA7637S1
Alternative Catalog Number: MBL-CNA7637S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-509 of human GLUT4 (NP_001033.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 55kDa
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: FLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Target: A synthetic peptide corresponding to a sequence within amino acids 450-509 of human GLUT4 (NP_001033.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200