Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA7638S
• Supplier Catalog Number: CNA7638S
• Alternative Catalog Number: MBL-CNA7638S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, IP, WB
• Species Reactivity: Human, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: DKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Target: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50