GYPB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7682T
Article Name: GYPB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7682T
Supplier Catalog Number: CNA7682T
Alternative Catalog Number: MBL-CNA7682T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-91 of human GYPB (NP_002091.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 10kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
Target: A synthetic peptide corresponding to a sequence within amino acids 1-91 of human GYPB (NP_002091.3).
Application Dilute: WB: WB,1:500 - 1:2000