Cytokeratin 13 (KRT13) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7697S
Article Name: Cytokeratin 13 (KRT13) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7697S
Supplier Catalog Number: CNA7697S
Alternative Catalog Number: MBL-CNA7697S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 50kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: DLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2).
Application Dilute: WB: WB,1:500 - 1:2000