Contactin 2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA7738S
Article Name: |
Contactin 2 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA7738S |
Supplier Catalog Number: |
CNA7738S |
Alternative Catalog Number: |
MBL-CNA7738S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 785-1012 of human Contactin 2 (NP_005067.1). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
113kDa |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
EVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVEN |
Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 785-1012 of human Contactin 2 (NP_005067.1). |
Application Dilute: |
WB: WB,1:500 - 1:2000 |