SQSTM1/p62 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7758P
Article Name: SQSTM1/p62 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7758P
Supplier Catalog Number: CNA7758P
Alternative Catalog Number: MBL-CNA7758P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-440 of human SQSTM1/p62 (NP_003891.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 48kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-440 of human SQSTM1/p62 (NP_003891.1).
Application Dilute: WB: IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200