RASGRP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7791S
Article Name: RASGRP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7791S
Supplier Catalog Number: CNA7791S
Alternative Catalog Number: MBL-CNA7791S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 78kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200