SLC22A11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7816P
Article Name: SLC22A11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7816P
Supplier Catalog Number: CNA7816P
Alternative Catalog Number: MBL-CNA7816P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human SLC22A11 (NP_060954.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 60kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human SLC22A11 (NP_060954.1).
Application Dilute: WB: WB,1:500 - 1:1000