CALHM1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA7858S
| Article Name: |
CALHM1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA7858S |
| Supplier Catalog Number: |
CNA7858S |
| Alternative Catalog Number: |
MBL-CNA7858S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 202-346 of human CALHM1 (NP_001001412.3). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
38kDa |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
VRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV |
| Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 202-346 of human CALHM1 (NP_001001412.3). |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200 |
