Na+/K+-ATPase Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7878P
Article Name: Na+/K+-ATPase Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7878P
Supplier Catalog Number: CNA7878P
Alternative Catalog Number: MBL-CNA7878P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human Na+/K+-ATPase (NP_000692.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 113kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARD
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human Na+/K+-ATPase (NP_000692.2).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200