STX1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7931S
Article Name: STX1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7931S
Supplier Catalog Number: CNA7931S
Alternative Catalog Number: MBL-CNA7931S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STX1A (Q16623).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 33kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STX1A (Q16623).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200