DDX39A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA7955P
Article Name: DDX39A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA7955P
Supplier Catalog Number: CNA7955P
Alternative Catalog Number: MBL-CNA7955P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX39A (NP_005795.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVL
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX39A (NP_005795.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200