PHD3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8001P
Article Name: PHD3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8001P
Supplier Catalog Number: CNA8001P
Alternative Catalog Number: MBL-CNA8001P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PHD3 (NP_071356.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 27kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDR
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PHD3 (NP_071356.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200