CCR8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8048S
Article Name: CCR8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8048S
Supplier Catalog Number: CNA8048S
Alternative Catalog Number: MBL-CNA8048S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 296-355 of human CCR8 (NP_005192.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 41kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 296-355 of human CCR8 (NP_005192.1).
Application Dilute: WB: WB,1:500 - 1:2000