CST7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8164S
Article Name: CST7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8164S
Supplier Catalog Number: CNA8164S
Alternative Catalog Number: MBL-CNA8164S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human CST7 (NP_003641.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human CST7 (NP_003641.3).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200