SULT2A1 Rabbit mAb, Clone: [ARC1853], Unconjugated, Monoclonal

Catalog Number: MBL-CNA8334S
Article Name: SULT2A1 Rabbit mAb, Clone: [ARC1853], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA8334S
Supplier Catalog Number: CNA8334S
Alternative Catalog Number: MBL-CNA8334S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-285 of human SULT2A1 (Q06520).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1853]
Molecular Weight: 34kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 180-285 of human SULT2A1 (Q06520).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200