XPC Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8354S
Article Name: XPC Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8354S
Supplier Catalog Number: CNA8354S
Alternative Catalog Number: MBL-CNA8354S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-940 of human XPC (NP_004619.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 106kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 700-940 of human XPC (NP_004619.3).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:50 - 1:100