CDC42EP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8480S
Article Name: CDC42EP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8480S
Supplier Catalog Number: CNA8480S
Alternative Catalog Number: MBL-CNA8480S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-254 of human CDC42EP3 (NP_006440.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 28kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-254 of human CDC42EP3 (NP_006440.2).
Application Dilute: WB: WB,1:500 - 1:2000