KDM4C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8485P
Article Name: KDM4C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8485P
Supplier Catalog Number: CNA8485P
Alternative Catalog Number: MBL-CNA8485P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 640-830 of human KDM4C (NP_055876.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 120kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 640-830 of human KDM4C (NP_055876.2).
Application Dilute: WB: WB,1:500 - 1:2000