RNF34 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8517S
Article Name: RNF34 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8517S
Supplier Catalog Number: CNA8517S
Alternative Catalog Number: MBL-CNA8517S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human RNF34 (NP_079402.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSAN
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human RNF34 (NP_079402.2).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200