ADRA2B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8535S
Article Name: ADRA2B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8535S
Supplier Catalog Number: CNA8535S
Alternative Catalog Number: MBL-CNA8535S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ADRA2B (NP_000673.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 50kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSI
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ADRA2B (NP_000673.2).
Application Dilute: WB: WB,1:500 - 1:2000