ALDH7A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8629S
Article Name: ALDH7A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8629S
Supplier Catalog Number: CNA8629S
Alternative Catalog Number: MBL-CNA8629S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 58kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).
Application Dilute: WB: WB,1:1000 - 1:4000|IF/ICC,1:50 - 1:200