RAIDD/CRADD Rabbit mAb, Clone: [ARC1770], Unconjugated, Monoclonal

Catalog Number: MBL-CNA8663S
Article Name: RAIDD/CRADD Rabbit mAb, Clone: [ARC1770], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA8663S
Supplier Catalog Number: CNA8663S
Alternative Catalog Number: MBL-CNA8663S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-199 of human RAIDD/CRADD (NP_003796.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1770]
Molecular Weight: 23kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Target: A synthetic peptide corresponding to a sequence within amino acids 100-199 of human RAIDD/CRADD (NP_003796.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200